PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2063	ARACIN1	25593351	"Arabidopsis thaliana"	Brassicaceae	Defensin	Antifungal	"Target site- Lipid Bilayer"	"Alternaria brassicicola(IC50: 5.46 µg/ml), Botrytis cinerea B05-10(IC50: 3.05 µg/ml), Fusarium graminearum(IC50: 28.17 µg/ml), Saccharomyces cerevisiae(IC50: 6.41 µg/ml), Sclerotinia sclerotiorum(IC50: 0.73 µg/ml)"	GSCGASIAEFNSSQILAKRAPPCRRPRLQNSEDVTHTTLP	40	"Experimental evidence at protein level"	4309.84	4307.17	8.96	--NA--	"Synthesis Type: Ribosomal/ 34% SIMILAR TO wasp PP102. Active against agronomically and economically important necrotrophic fungi, B. cinerea, A. brassicicola, F. graminearum, S. sclerotiorum, and the yeast S. Cerevisiae."