PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2062	ARACIN2	25593351	"Arabidopsis thaliana"	Brassicaceae	Defensin	Antifungal	"Target site- Lipid Bilayer"	"Alternaria brassicicola(IC50: 1.55 µg/ml), Fusarium graminearum(IC50: 9.06 µg/ml), Saccharomyces cerevisiae(IC50: 0.76 µg/ml), Sclerotinia sclerotiorum(IC50: 0.49 µg/ml)"	GSCGAPISKYDFQVLAKRPPPCRRPRLENTEDVTHTTRP	39	Predicted	4395	4392.23	9.38	--NA--	"Synthesis Type: Ribosomal/ 70% SIMILAR TO ARACIN1. Active against agronomically and economically important necrotrophic fungi, B. cinerea, A. brassicicola, F. graminearum, S. sclerotiorum, and the yeast S. Cerevisiae."