PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2043	ZmESR-6	16027978	"Zea mays"	Poaceae	Defensin	"Antifungal, Antibacterial"	"Protect the embryo at the very early stages of seed development, and defence mechanism of the kernel at later developmental stages"	"Clavibacter michiganensis (IC50=0.2µM), Xanthomonas campestris (IC50=15µM), Rhizobium melilote (IC50=5µM), Fusariumk oxyosporium f.sp. (IC50=3 ± 1µM), Fusarium oxyosporum f.sp.lycopersici (IC50=3 ± 1µM), Plectosphaerella cucumerina (IC50=2µM)"	KLCSTTMDLLICGGAIPGAVNQACDDTCRNKGYTGGGFCNMKIQRCVCRKPC	52	"Experimental evidence at protein level"	5516.51	5512.54	8.73	"PCR, SDS-PAGE"	NA