PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2042	"TvD1 defensin"	18726095	"Tephrosia villosa"	Fabaceae	Defensin	Antifungal	"Showed significant inhibition of root elongation in Arabidopsis seedlings, and affecting the extension of growing root hairs indicates that it has the potential to disturb the plant growth and development."	"F. oxysporum and F. moniliforme"	KTCENLADTYRGPCFTTGSCDDHCKNKEHLLSGRCRDDFRCWCTKRC	47	"Experimental evidence at protein level"	5475.18	5471.38	8.2	Micro-spectrophotometry	NA