PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2022	Mra30	"21723349, 19462049, 26399495"	"Viola tricolor, Melicytus ramiflorus, Viola philippica"	Violaceae	Cyclotide	"Cytotoxic, Enzymatic-degradation, Antimicrobial, Anticancer"	"Shown to possess cytotoxic and enzymatic degradation activity, participates in a plant defense mechanism."	"Human skin melanoma MM96L(IC50: 4.91 ±0.04 µM), Human cervical carcinoma HeLa(IC50: 15.5 ±0.06 µM), Human gastric cancer BGC-823(IC50: 1.75 ±0.05 µM)"	GIPCGESCVFIPCLTSAIGCSCKSKVCYRN	30	"Experimental evidence at protein level"	3139.74	3137.43	8.33	"MS, PcR"	"Predicted from precursor / Synthesis Type: Ribosomal, Target site- Lipid Bilayer; Human foreskin fibroblasts HFF-1(IC50: 3.19 ±0.01 µM)"