PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1984	"vitri peptide 24a"	26399495	"Viola tricolor"	Violaceae	Cyclotide	Antimicrobial	"participates in a plant defense mechanism."	--NA--	GGTIFNCGESCFQGTCYTKGCACGDWKLCYGEN	33	"Experimental evidence at protein level"	3516.93	3514.39	4.68	"NGS, MS"	"Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues. Also, possible ethylation of glutamic acid residues (Hellinger et al. 2015), It serves as the starting point for future bioactivity-guided screening studies."
