PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1970	"Mech 1"	26322745	"Melicytus chathamicus"	Violaceae	Cyclotide	"Cytotoxic, Antibacterial"	"Shows cytotoxocity against cancer cell lines and low toxicity against red blood cells, Target site- Lipid Bilayer"	"Cancer cell lines and red blood cells/ Escherichia coli, Staphylococcus aureus"	GVIPCGESCVFIPCINKKKCSCKNKVCYRD	30	"Experimental evidence at protein level"	3336.04	3333.6	8.89	MS	" I/L not differentiated. (Ravipati et al. 2015) / Synthesis Type: Ribosomal; Not active up to 64 µM-Escherichia coli, Staphylococcus aureus"