PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1833	"chassatide C16"	22467870	"Chassalia chartacea"	Rubiaceae	Cyclotide	"Antimicrobial, Cytotoxic, Hemolytic"	"Shown to possess antimicrobial, cytotoxic, and hemolytic activities and the oxidation of two Met residue causes loss of bioactivities, strengthening the importance of the hydrophobic patch for membrane interaction."	"Staphylococcus aureus,  Staphylococcus epidermidis, and  Escherichia coli"	GVPCAESCVYIPCTITALFGCSCKDKVCYNN	31	"Experimental evidence at protein level"	3302.87	3300.45	6.03	"PcR, Genomic"	NA