PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1827	"Caripe 8"	--NA--	"Carapichea ipecacuanha"	Rubiaceae	Cyclotide	--NA--	"Shown to possess antimicrobial, cytotoxic, and hemolytic activities and the oxidation of two Met residue causes loss of bioactivities, strengthening the importance of the hydrophobic patch for membrane interaction."	--NA--	GVIPCGESCVFIPCITAAIGCSCKKKVCYRN	31	"Experimental evidence at protein level"	3263.97	3261.57	8.66	"MS, Amino acid analysis"	"Retrieved from the 1KP project. Credit should be given to the 1KP project if using this sequence http://www.onekp.com/. Sequence confirmed by MS amino acid analysis. Inhibits CRF1R-mediated cAMP responses (Fahradpour et al)."