PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1703	"kalata B19"	20158917	"Oldenlandia affinis"	Rubiaceae	Cyclotide	"Antibacterial, Cytotoxic, Anti-HIV"	"Shown to possess anti-bacterial, cytotoxic and anti-HIV activity."	--NA--	GFPCGESCVYVPCLTAAIGCSCSNKVCYKN	30	"Experimental evidence at protein level"	3117.65	3115.34	7.76	EST	"The sequence was predicted from an EST assembly. "