PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1603	Vhl-2	15824119	"Viola hederacea"	Violaceae	Cyclotide	"Antiviral, Anti-HIV, Anticancer"	"Shown to possess anti-HIV activity; Participate in the innate immune response of plants, therapeutically useful as anticancer agents and novel antimicrobial compounds in the protection of crops to the disinfection of hospital environments."	"Virus: HIV."	GLPVCGETCFTGTCYTNGCTCDPWPVCTRN	30	"Experimental evidence at protein level"	3199.63	3197.28	4.37	PcR	NA