PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1575	Cycloviolacin-O4	"16872274, 29757646, 10600388"	"Viola odorata, Viola tricolor, Pombalia calceolaria"	"Violaceae, Calceolariaceae"	Cyclotide	"Antimicrobial, Anticancer"	"Shown to possess anticancer activity; participates in a plant defense mechanism."	--NA--	GIPCGESCVWIPCISSAIGCSCKNKVCYRN	30	"Experimental evidence at protein level"	3191.78	3189.44	8.33	MS	"Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues. The sequence was identified after trypsin/endoproteinase GluC double digest. IC50 of 9.8 ?M against MDA-MB-231 breast cancer cell line; cross link- SWISS P58436, PHYT00179"