PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1567	Ct-AMP1	7628617	"Clitoria ternatea"	Fabaceae	Defensin	"Antifungal, Antimicrobial"	"Inhibition of in vitro protein synthesis and inhibition of alpha-amylases. It also show antimicrobial activity"	"fungi B. cinerea (IC50= 20 µg/ml), C. sphaerospermum (IC50= 6 µg/ml), F. culmorum (IC50= 10 µg/ml), L. maculans (IC50= 6 µg/ml), P. digitatum (IC50= 20 µg/ml), S. tritici (IC50= 2 µg/ml), and V. albo-atrum (IC50= 2 µg/ml)"	NLCERASLTWTGNCGNTGHCDTQCRNWESAKHGACHKRGNWKCFCYFDC	49	"Experimental evidence at protein level"	5614.25	5610.34	8.21	"RP-HPLC, SDS-PAGE"	"In medium A supplemented with 1 mM CaCl2 and 50 mM KCl, (FEBS Lett. 1995 Jul 17;368(2):257-62). Replaced 7/2008; updated Jan2017, GW."