PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1565	Beta-purothionin	"5031563, 990986, 914810, 15299761"	"Triticum aestivum"	Poaceae	Thionin	"Antibacterial, Antifungal, Antiyeast, Toxin"	"is toxic to animal cells"	"Pseudomonas solanAngiotensin Converting Enzymearum ( MIC = 1.5 µg/ml ), Xanthomonas phaseoli ( MIC = 12 µg/ml )"	KSCCKSTLGRNCYNLCRARGAQKLCANVCRCKLTSGLSCPKDFPK	45	"Experimental evidence at protein level"	4926.88	4923.4	9.54	X-ray	"Antimicrobial activity was observed as early as 1895 and the protein components crystallized in 1941. However, these effects are due to a mixture of purothionins till 1972. In this 1974 study, antibacterial activity of both mixture and separated alpha and beta-thionins were evaluated. In particular, the peptide showed activity against pathogens of plant origin. Amino acid sequence was reported in 1976 (Can J Biochem). Crystal structure was reported in 1995 (see the PDB link). You can rotate, zoom, and view the tetrameric crystal structure here in the PDB. It probably works by forming ion channels in membranes (JBC2000). Updated 2/2014; Ref 3/2015; 8/2015."