PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1558	SIalpha1	9715910	"Sorghum bicolor"	Poaceae	Defensin	"Antimicrobial, Antifungal"	--NA--	"fungi B. cinerea (IC50= 100 µg/ml), C. sphaerospermum (IC50= 80 µg/ml), and T. viride (IC50= 50 µg/ml)"	RVCMKGSQHHSFPCISDRLCSNECVKEEGGWTAGYCHLRYCRCQKAC	47	"Experimental evidence at protein level"	5382.2	5378.36	8.51	NMR	"In medium A supplemented with 1 mM CaCl2 and 50 mM KCl, (FEBS Lett. 1995 Jul 17;368(2):257-62). Updated Jan2017 GW."