PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1552	TPP3	22442231	"Solanum lycopersicum"	Solanaceae	Defensin	"Antimicrobial, Antifungal, Anticancer"	--NA--	--NA--	QICKAPSQTFPGLCFMDSSCRKYCIKEKFTGGHCSKLQRKCLCTKPC	47	"Experimental evidence at protein level"	5305.36	5301.52	9.2	X-ray	"MOA: TPP3 interacts with plasma membrane phosphatidylinositol(4,5)-bisphosphate (PIP2) to mediate membrane permeabilization. TPP3 forms an oligomer with PIP2 (or PI(4,5)P2) in vitro and has been crystallized. It can also toxic to cancer cells U937 and induces plasma membrane blebs (Baxter AA et al., 2015). You can rotate, zoom, and view the 3D structure here in the PDB . Updated 3/2015. | K6, K42"