PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_1537	Ha-DEF1	17375322	"Helianthus annuus"	Asteraceae	Defensin	Antifungal	--NA--	"Saccharomyces cerevisiae, Alternaria brassicicola"	ELCEKASQTWSGTCGKTKHCDDQCKSWEGAAHGACHVRDGKHMCFCYFNC	50	"Experimental evidence at protein level"	5599.29	5595.31	7.09	--NA--	"This peptide is only expresed in the root of sunflower. A recombinant form was active against S. cerevisiae (related to membrane permeabilization). It also showed lethal effects on parasitic plants. Updated 11/2015."